Global Trade leader ecrobot

본문 바로가기
Home > Product > search Tempered acid etched
Products 11,350 Result
HD Clear Tablet Tempered Glass Screen Protector For IPad Pro 12.9 Inch...
Aug 15 2017
12.9 Inch 9H Hardness HD Clear Tablet Tempered glass screen protector for IPad Pro # Thinnest thickness: 0.15mm/ 0.2mm/ / 0.3mm. # Whole Transparency: The transmittance is up to 98%. # Sur…
HS-CODE : 85-
Category : | Electrical machinery and
SHENZHEN GOBELIKE TECHNO...
China [CN]
Scince 2006
Free Member
0.33mm Curved 3D Tempered Glass Screen Protector Film For Samsung Gala...
Aug 15 2017
9H Full Cover 3D Curved Tempered Glass screen protector for Samsung Galaxy S8 Mobile Phone Product Description - - - - 1 | Place of Origin | Guang Dong China(Mainland) | 2 | Model …
HS-CODE : 85-
Category : | Electrical machinery and
SHENZHEN GOBELIKE TECHNO...
China [CN]
Scince 2006
Free Member
Samsung Galaxy S8 3D Tempered Glass Screen Protector Transperent Bubbl...
Aug 15 2017
3DfullcurvedcasefriendlytemperedglassscreenprotectorSamsungGalaxy S8 - - - - Item: | S8 Plus 3D Glass, Case Friendly Full Cover Tempered Glass Screen Protector | Model No. | …
HS-CODE : 85-
Category : | Electrical machinery and
SHENZHEN GOBELIKE TECHNO...
China [CN]
Scince 2006
Free Member
9H Hardness IPhone Tempered Glass Screen Protector Full Cover 2.5D Bub...
Aug 15 2017
9H Hardness Bubble Free 0.3 2.5D Tempered Glass Screen Protector for iPhone 7 Features: 1. With 2 or 3 layers 2. Made of chemical processed glass, which has excellent window display, …
HS-CODE : 85-
Category : | Electrical machinery and
SHENZHEN GOBELIKE TECHNO...
China [CN]
Scince 2006
Free Member
Full Cover IPhone Tempered Glass Screen Protector Scratch Resistant Ro...
Aug 15 2017
9H Hardness Full Cover 3D Tempered Glass Screen Protector for iPhone 8 Description: # Made from the Highest Quality Tempered-Glass with 100% Bubble-Free Adhesives for easy installation and n…
HS-CODE : 85-
Category : | Electrical machinery and
SHENZHEN GOBELIKE TECHNO...
China [CN]
Scince 2006
Free Member
ISOXAZOLE-4-CARBOXYLIC ACID ETHYL ESTER
Aug 14 2017
cas 80370-40-7
HS-CODE : -
Category :
Tianjin Chempharmatech.C...
China [CN]
Scince 0
Free Member
Amino acid organic plant fertilizer
Aug 12 2017
Unlike the chemical kind, organic fertilizers feed soil organisms in addition to your plants, helping to build healthy soil—not destroy it.     Nam…
HS-CODE : 3101-00
Category : | Fertilisers | Animal or vegetable fert | Animal/vegetable fertili
Shandong New Power Eco-A...
China [CN]
Scince 2015
Free Member
high nitrogen organic fertilizer including amino acid
Aug 12 2017
Unlike the chemical kind, organic fertilizers feed soil organisms in addition to your plants, helping to build healthy soil—not destroy it.     Nam…
HS-CODE : 3101-00
Category : | Fertilisers | Animal or vegetable fert | Animal/vegetable fertili
Shandong New Power Eco-A...
China [CN]
Scince 2015
Free Member
amino acid organic fertilizer for vegetables
Aug 12 2017
Unlike the chemical kind, organic fertilizers feed soil organisms in addition to your plants, helping to build healthy soil—not destroy it.     Name …
HS-CODE : 3101-00
Category : | Fertilisers | Animal or vegetable fert | Animal/vegetable fertili
Shandong New Power Eco-A...
China [CN]
Scince 2015
Free Member
Indole broad-spectrum plant growth regulator auxin Indole 3 Acetic Aci...
Aug 12 2017
Indole broad-spectrum plant growth regulator auxin Indole 3 Acetic Acid IAA,Cell Division Plant Hormones url:http://www.plantgrowthhormones.com
HS-CODE : -
Category :
Zhengzhou Delong Chemica...
China [CN]
Scince 0
Free Member
Natural Plant Growth Hormones Gibberellins Gibberellic Acid GA4+7 For ...
Aug 12 2017
Natural Plant Growth Hormones Gibberellins Gibberellic Acid GA4+7 For Apple,Website:http://www.plantgrowthhormones.com,Cell Division Plant Hormones
HS-CODE : -
Category :
Zhengzhou Delong Chemica...
China [CN]
Scince 0
Free Member
Mastic Gum Extract Powder,mastic Acid 65% Supplier Wholesale
Aug 11 2017
Asclepius Bio-Tech offers you the mastic gum extract powder,mastic acid 65% supplier wholesale. Welcome to buy or wholesale the TOP quality, organic and natural products for sale from our manufacturer…
HS-CODE : -
Category :
Xi'an Asclepius Bio-Tech...
China [CN]
Scince 0
Free Member
Rosemary Leaf Extract Supplement Supplier Wholesale/ Rosmarinic Acid
Aug 11 2017
Asclepius Bio-Tech offers you the rosemary leaf extract supplement supplier wholesale/ rosmarinic acid. Welcome to buy or wholesale the TOP quality, organic and natural products for sale from our manu…
HS-CODE : -
Category :
Xi'an Asclepius Bio-Tech...
China [CN]
Scince 0
Free Member
Phosphorous Acid CAS 13598-36-2
Aug 11 2017
Phosphorous Acid CAS 13598-36-2,Intermediate Of Agrochemicals url:http://www.shandongxinhuapharma.com
HS-CODE : -
Category :
Shandong Xinhua Pharmace...
China [CN]
Scince 0
Free Member
DBU / Octanoic Acid Salt CAS 33918-18-2
Aug 11 2017
DBU / Octanoic Acid Salt CAS 33918-18-2,Intermediate Of Dyestuff & Additive Of Polymer url:http://www.shandongxinhuapharma.com
HS-CODE : -
Category :
Shandong Xinhua Pharmace...
China [CN]
Scince 0
Free Member
ECROBOT CO., Ltd, Business Registration Number : 220-88-71747, CEO J.W.Park, TEL : +82-2-552-7676, E-mail : E-mail : Contact us
Address : (Hwanghwa B/D 11F, Yeoksam-dong)320, Gangnam-daero, Gangnam-gu, Seoul, South Korea
About Us Privacy Policy Terms of use Copyright © 2000-2024 ECROBOT.COM. All rights reserved.
Top